viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag[Gene ID: 1491934 ]
♦Gag polyprotein (Pr53Gag) [Cleaved into: Matrix protein p19 (MA)
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-gag (NC-gag)]
Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
MGQIFSRSASPIPRPPRGLAAHHWLNFLQAAYRLEPGPSSYDFHQLKKFLKIALETPVWICPINYSLLASLLPKGYPGRVNEILHILIQTQAQIPSRPAP
PPPSSSTHDPPDSDPQIPPPYVEPTAPQVLPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASL
HHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILR
SLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKDKTKVLVVQPKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPRLKPTI
PEPEPEEDALLLDLPADIPHPKNSIGGEV
429
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Gag polyprotein: The matrix domain targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus.
♦ Matrix protein p19: Matrix protein.
♦ Capsid protein p24: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15-gag: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs.
Not Available
GO:0003676  ;   GO:0005198  ;   GO:0008270  ;   GO:0016032  ;   GO:0019013  
♦ Matrix protein p19: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-gag: Virion .
Not Available
MOTIF 118 121 PPXY motif. ; MOTIF 124 127 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available