Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag[Gene ID: 1491934 ]
♦Gag polyprotein (Pr53Gag) [Cleaved into: Matrix protein p19 (MA)
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-gag (NC-gag)]
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-gag (NC-gag)]
Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
MGQIFSRSASPIPRPPRGLAAHHWLNFLQAAYRLEPGPSSYDFHQLKKFLKIALETPVWICPINYSLLASLLPKGYPGRVNEILHILIQTQAQIPSRPAP
PPPSSSTHDPPDSDPQIPPPYVEPTAPQVLPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASL
HHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILR
SLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKDKTKVLVVQPKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPRLKPTI
PEPEPEEDALLLDLPADIPHPKNSIGGEV
PPPSSSTHDPPDSDPQIPPPYVEPTAPQVLPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASL
HHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILR
SLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKDKTKVLVVQPKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPRLKPTI
PEPEPEEDALLLDLPADIPHPKNSIGGEV
429
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Gag polyprotein: The matrix domain targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus.
♦ Matrix protein p19: Matrix protein.
♦ Capsid protein p24: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15-gag: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs.
♦ Matrix protein p19: Matrix protein.
♦ Capsid protein p24: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15-gag: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs.
Not Available
♦ Matrix protein p19: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-gag: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-gag: Virion .
Not Available
MOTIF 118 121 PPXY motif. ; MOTIF 124 127 PTAP/PSAP motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available