Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Gag-pro prt[Gene ID: 1724741 ]
♦Gag-Pro polyprotein (Pr76Gag-Pro) [Cleaved into: Matrix protein p19 (MA)
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-pro (NC') (NC-pro)
♦ Protease (PR) (EC 3.4.23.-)
♦ p1
♦ Transframe peptide (TFP) (p8)]
♦ Capsid protein p24 (CA)
♦ Nucleocapsid protein p15-pro (NC') (NC-pro)
♦ Protease (PR) (EC 3.4.23.-)
♦ p1
♦ Transframe peptide (TFP) (p8)]
Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
MGQIFSRSASPIPRPPRGLAAHHWLNFLQAAYRLEPGPSSYDFHQLKKFLKIALETPVWICPINYSLLASLLPKGYPGRVNEILHILIQTQAQIPSRPAP
PPPSSSTHDPPDSDPQIPPPYVEPTAPQVLPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASL
HHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILR
SLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKDKTKVLVVQPKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPRLKPTI
PEPEPEEDALLLDLPADIPHPKNLHRGGGLTSPPTLQQVLPNQDPTSILPVIPLDPARRPVIKAQIDTQTSHPKTIEALLDTGADMTVLPIALFSSNTPL
KNTSVLGAGGQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAIIGRDALQQCQGVLYLPEAKRPPVILPIQAPAVLGLEHLPRPPEISQFPLNQ
NASRPCNTWSGRPWRQAISNPTPGQEITQYSQLKKPMEPGDSSTTCGPLTL
PPPSSSTHDPPDSDPQIPPPYVEPTAPQVLPVMHPHGAPPNHRPWQMKDLQAIKQEVSQAAPGSPQFMQTIRLAVQQFDPTAKDLQDLLQYLCSSLVASL
HHQQLDSLISEAETRGITGYNPLAGPLRVQANNPQQQGLRREYQQLWLAAFAALPGSAKDPSWASILQGLEEPYHAFVERLNIALDNGLPEGTPKDPILR
SLAYSNANKECQKLLQARGHTNSPLGDMLRACQAWTPKDKTKVLVVQPKKPPPNQPCFRCGKAGHWSRDCTQPRPPPGPCPLCQDPTHWKRDCPRLKPTI
PEPEPEEDALLLDLPADIPHPKNLHRGGGLTSPPTLQQVLPNQDPTSILPVIPLDPARRPVIKAQIDTQTSHPKTIEALLDTGADMTVLPIALFSSNTPL
KNTSVLGAGGQTQDHFKLTSLPVLIRLPFRTTPIVLTSCLVDTKNNWAIIGRDALQQCQGVLYLPEAKRPPVILPIQAPAVLGLEHLPRPPEISQFPLNQ
NASRPCNTWSGRPWRQAISNPTPGQEITQYSQLKKPMEPGDSSTTCGPLTL
651
Not Available
Not Available
23-01-2007
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Gag-Pro polyprotein: The matrix domain targets Gag, Gag-Pro and Gag-Pro-Pol polyproteins to the plasma membrane via a multipartite membrane binding signal, that includes its myristoylated N-terminus.
♦ Matrix protein p19: Matrix protein.
♦ Capsid protein p24: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15-pro: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs.
♦ Protease: The aspartyl protease mediates proteolytic cleavages of Gag and Gag-Pol polyproteins during or shortly after the release of the virion from the plasma membrane. Cleavages take place as an ordered, step-wise cascade to yield mature proteins. This process is called maturation. Displays maximal activity during the budding process just prior to particle release from the cell (Potential). Cleaves the translation initiation factor eIF4G leading to the inhibition of host cap-dependent translation (By similarity).
♦ Matrix protein p19: Matrix protein.
♦ Capsid protein p24: Forms the spherical core of the virus that encapsulates the genomic RNA-nucleocapsid complex.
♦ Nucleocapsid protein p15-pro: Binds strongly to viral nucleic acids and promote their aggregation. Also destabilizes the nucleic acids duplexes via highly structured zinc-binding motifs.
♦ Protease: The aspartyl protease mediates proteolytic cleavages of Gag and Gag-Pol polyproteins during or shortly after the release of the virion from the plasma membrane. Cleavages take place as an ordered, step-wise cascade to yield mature proteins. This process is called maturation. Displays maximal activity during the budding process just prior to particle release from the cell (Potential). Cleaves the translation initiation factor eIF4G leading to the inhibition of host cap-dependent translation (By similarity).
3.4.23.-
♦ Matrix protein p19: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-pro: Virion .
♦ Capsid protein p24: Virion .
♦ Nucleocapsid protein p15-pro: Virion .
DOMAIN 476 554 Peptidase A2.
MOTIF 118 121 PPXY motif. ; MOTIF 124 127 PTAP/PSAP motif.
Predicted/Modelled
Not Available
♦ACT_SITE 481 481 For protease activity
♦ shared with dimeric partner.
♦ shared with dimeric partner.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available