viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Mastomys Natalensis (African Soft-furred Rat) (Praomys Natalensis) [TaxID: 10112]
N[Gene ID: 956584 ]
Nucleoprotein (EC 3.1.13.-) (Nucleocapsid protein) (Protein N)
Lassa Virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Arenaviridae> Mammarenavirus> Lassa Mammarenavirus> Lassa Virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV)
Not Available
Various pathway(s) in which protein is involved
Not Available
MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRDDNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLL
ILAADLEKLKSKVIRTERPLSAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMPSLTLACLTKQGQVDLNDAVQ
ALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLNISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKKALGMFISDTPGER
NPYENILYKICLSGDGWPYIASRTSITGRAWENTVVDLESDGKPQKADSNNSSKSLQSAGFTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEI
ALYQPSSGCYIHFFREPTDLKQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIKLIDIALSKTDSRKYENAVWD
QYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAAVSGGLNTSVLRAVLPRDMVFRTSTPRVVL
569
Not Available
Not Available
01-01-1990
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Encapsidates the genome, protecting it from nucleases. The encapsidated genomic RNA is termed the nucleocapsid (NC). Serves as template for viral transcription and replication. The increased presence of protein N in host cell does not seem to trigger the switch from transcription to replication as observed in other negative strain RNA viruses. Through the interaction with host IKBKE, strongly inhibits the phosphorylation and nuclear translocation of host IRF3, a protein involved in interferon activation pathway, leading to the inhibition of interferon-beta and IRF3-dependent promoters activation. Encodes also a functional 3'-5' exoribonuclease that degrades preferentially dsRNA substrates and therby participates in the suppression of interferon induction.
3.1.13.-  
GO:0003723  ;   GO:0008408  ;   GO:0019013  ;   GO:0019029  ;   GO:0030430  ;  
GO:0030683  ;   GO:0039548  ;   GO:0039689  ;   GO:0039696  ;   GO:0039724  ;  
GO:0042802  ;   GO:0046872  
Virion . Host cytoplasm .
Not Available
Not Available
X-ray crystallography (11)
3MWP  3MWT  3MX2  3MX5  3Q7B  3Q7C  4FVU  4G9Z  4GV3  4GV6  4GV9  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available