Reviewed
Cercopithecus Hamlyni (Owl-faced Monkey) (Hamlyn's Monkey) [TaxID: 9536]; Homo Sapiens (Human) [TaxID: 9606]; Macaca (macaques) [TaxID: 9539]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]
Not Available
♦Genome polyprotein [Cleaved into: Protein VP3 (P1C) (Virion protein 3)
♦ Protein VP1-2A (PX)
♦ Protein VP1 (P1D) (Virion protein 1)
♦ Protein 2A] (Fragment)
♦ Protein VP1-2A (PX)
♦ Protein VP1 (P1D) (Virion protein 1)
♦ Protein 2A] (Fragment)
Human Hepatitis A Virus Genotype IA (isolate LCDC-1) (HHAV) (Human Hepatitis A Virus (isolate Human/China/LCDC-1/1984))
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Picornavirales> Picornaviridae> Hepatovirus> Hepatovirus A> Human Hepatitis A Virus> Human Hepatitis A Virus Genotype IA (isolate LCDC-1) (HHAV) (Human Hepatitis A Virus (isolate Human/China/LCDC-1/1984))
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
QVGDDSGGFSTTVSTEQNVPDPQVGIKGKANRGKMDVSGVQAPVGAITTIEDPVLAKKVPETFPELKPGESRHTSDHMSIYKFMGRSHFLCTFTFNSNNK
EYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKASALSIDYKTALGAVRFNTRRTGNIQIRLPWY
SYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLESSVDDPRSEEDRRFESHIEC
RKPYKELRLEVGKQRLKYAQEELSNEVLPPPRKMKGLFSQS
EYTFPITLSSTSNPPHGLPSTLRWFFNLFQLYRGPLDLTIIITGATDVDGMAWFTPVGLAVDTPWVEKASALSIDYKTALGAVRFNTRRTGNIQIRLPWY
SYLYAVSGALDGLGDKTDSTFGLVSIQIANYNHSDEYLSFSCYLSVTEQSEFYFPRAPLNSNAMLSTESMMSRIAAGDLESSVDDPRSEEDRRFESHIEC
RKPYKELRLEVGKQRLKYAQEELSNEVLPPPRKMKGLFSQS
341
Not Available
Not Available
01-01-1990
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Capsid proteins VP1, VP2, and VP3 form a closed capsid enclosing the viral positive strand RNA genome. All these proteins contain a beta-sheet structure called beta-barrel jelly roll. Together they form an icosahedral capsid (T=3) composed of 60 copies of each VP1, VP2, and VP3, with a diameter of approximately 300 Angstroms. VP1 is situated at the 12 fivefold axes, whereas VP2 and VP3 are located at the quasi-sixfold axes. The capsid interacts with HAVCR1 to provide virion attachment to target cell (By similarity).
♦ VP1-2A precursor is a component of immature procapsids and corresponds to an extended form of the structural protein VP1. The C-terminal domain of VP1-2A, protein 2A, acts as an assembly signal that allows multimerization of VP1-2A and formation of pentamers of VP1-VP2-VP3 trimers. It is proteolytically removed from the precursor by a host protease and does not seem to be found in mature particles (By similarity).
♦ VP1-2A precursor is a component of immature procapsids and corresponds to an extended form of the structural protein VP1. The C-terminal domain of VP1-2A, protein 2A, acts as an assembly signal that allows multimerization of VP1-2A and formation of pentamers of VP1-VP2-VP3 trimers. It is proteolytically removed from the precursor by a host protease and does not seem to be found in mature particles (By similarity).
Not Available
Protein VP1-2A: Virion . Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available