viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NS
Non-structural protein 1 (NS1) (NS1A)
Influenza B Virus (strain B/HT/1984)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Betainfluenzavirus> Influenza B Virus> Influenza B Virus (strain B/HT/1984)
Various pathway(s) in which protein is involved
Not Available
Not Available
MADHMNTTQIEVGPGATNDTINFGAGILECYERLSWQRALDYPGQDRLNRLKRKLESRIKTHNKSEPEGTRMSLEERKAIGVKMMKVLLFMNPSAGIEGF
EPYCMKNSSNSNCPNYNWTDYPPTPGRCLDDIEEEPEDVDDPTEIVLRDMNNKDARQKIKEEVNTQKEGKFRLTIKRDIRNVLSLRVLVNGTFLKHPNGY
KTLSTLHRLNAYDQSGRLVAKLVATDDLTVEDEEDGHRILNSLFERLNEGHSKPIRAAETAVGVLSQFGQEHRLSPEEGDN
281
Not Available
Not Available
01-10-1989
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Binds and inhibits the conjugation of the ubiquitin-like G1P2/ISG15 protein to its target proteins. Since G1P2/ISG15 is an early antiviral protein, NS1 may inhibit the host antiviral response. Prevents EIF2AK2/PKR activation, either by binding double strand RNA or by interacting directly with EIF2AK2/PKR. Also binds poly(A) and U6 snRNA.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039502  ;   GO:0039579  ;   GO:0039580  ;  
GO:0042025  
Host cytoplasm . Host nucleus .
Not Available
MOTIF 50 55 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available