Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vpr
Protein Vpr (R ORF protein) (Viral protein R)
Human Immunodeficiency Virus Type 2 Subtype A (isolate SBLISY) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> Human Immunodeficiency Virus Type 2 Subtype A (isolate SBLISY) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MTEAPAEFPPEDGTPPREPGDEWVIEILREIKEEALKHFDPRLLTALGYYIYTRHGDTLEGARELIRVLQRALFTHFRAGCGHSRIGQPRGRNPLSAIPT
PRNMQ
PRNMQ
105
Not Available
Not Available
01-10-1989
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Stimulates gene expression driven by the HIV-2 LTR. Prevents infected cells from undergoing mitosis and proliferating, by inducing arrest or delay in the G2 phase of the cell cycle. Cell cycle arrest creates a favorable environment for maximizing viral expression and production (By similarity).
Not Available
GO:0006351 ; GO:0006355 ; GO:0007049 ; GO:0019012 ; GO:0039592 ;
GO:0042025 ; GO:0046718 ; GO:0075732
GO:0042025 ; GO:0046718 ; GO:0075732
Virion. Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available