Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vif
Virion infectivity factor (Vif) (Q protein) (SOR protein)
Human Immunodeficiency Virus Type 2 Subtype A (isolate SBLISY) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> Human Immunodeficiency Virus Type 2 Subtype A (isolate SBLISY) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDQGKRWIAVPTWRVPGRMEKWHSLIKYLKYRTKDLEQVRYVPHHKVGWAWWTCSRVIFPLKGNSHLEIQAYWNLTPEKGWLSSYSVRMTWYSEGFWTDV
TPDCADTLIHSTYFSCFTAGEVRRAIRGEKSLSCCNYPQAHKSKVPSLQFLALVVVQQNDKPQRDNTTRKQWRRNYRRGLRLARQDGRSHKQRGSEPPAQ
GAYFPGVAKVLEILA
TPDCADTLIHSTYFSCFTAGEVRRAIRGEKSLSCCNYPQAHKSKVPSLQFLALVVVQQNDKPQRDNTTRKQWRRNYRRGLRLARQDGRSHKQRGSEPPAQ
GAYFPGVAKVLEILA
215
Not Available
Not Available
01-10-1989
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Counteracts the innate antiviral activity of APOBEC3G. Forms a complex with host APOBEC3G thus preventing the entry of this lethally hypermutating enzyme into progeny virions. Functions as an adapter molecule, recruiting APOBEC3G to the ubiquitin-proteasome machinery. Targets APOBEC3G for degradation through the assembly with elongin BC complex, CUL5 and RBX1. Binds viral RNA and affects the stability of viral nucleoprotein core. May play a role in viral morphology (By similarity).
Not Available
♦ Host cytoplasm . Host cell membrane
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor (By similarity). .
♦ Peripheral membrane protein
♦ Cytoplasmic side . Virion . Note=In the cytoplasm, seems to colocalize with intermediate filament vimentin. A fraction is associated with the cytoplasmic side of cellular membranes, presumably via the interaction with Pr55Gag precursor (By similarity). .
Not Available
MOTIF 110 141 HCCH motif. ; MOTIF 147 156 BC-box-like motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available