viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L4[Gene ID: 2715920 ]
Shutoff protein (100 kDa protein) (p100K) (100K-chaperone protein) (L4-100K) (Shutoff protein 100K)
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
MEEDLKLQPDSETLTTPNSEVGAVELVKHEEENEQVEQDPGYVTPPEDGKEPVAALSEPNYLGGEDDVLLKHIARQSTIVREALKECTQTPLTVEELSRA
YEANLFSPRVPPKKQPNGTCETNPRLNFYPVFAVPEALATYHIFFKNQRIPLSCRANRTRGDGLLHLKAGAHIPEIVSLEEVPKIFEGLGKDEKRAANAL
QKNETENQNVLVELEGDNARLAVLKRTIEVSHFAYPALNLPPKVMRSVMDQVLIKRAEPIDPQQPDLNSEDGQPVVSDDELARWLGTQDPSELQERRKMM
MAAVLVTVELECLQRFFANPQTLRKVEESLHYAFRHGYVRQACKISNVELSNLISYMGILHENRLGQNVLHCTLQGEARRDYVRDCIYLFLILTWQTAMG
VWQQCLEEQNLQELNKLLVRARRELWTSFDERTVARQLANLIFPERLMQTLQNGLPDFVSQSILQNFRSFVLERSGILPAMSCALPSDFVPLCYRECPPP
LWSHCYLLRLANYLAHHSDLMEDSSGDGLLECHCRCNLCTPHRSLVCNTELLSETQVIGTFEIQGPEQQEGASSLKLTPALWTSAYLRKFIPEDYHAHQI
KFYEDQSRPPKVPLTACVITQSQILAQLQAIQQARQEFLLKKGHGVYLDPQTGEELNTPSLSAAASCRSQKHATQGKQASHRATAIPAETTKAVGRGGDV
GRQPGRGSFRRGGGGADGELGQPRRGGPRGRGGRNHRQRQGTIFQKTRSEPTSENYPAPATATMFTESQP
770
Not Available
Not Available
01-02-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Protein that inhibits host translation while promoting late viral translation by ribosome shunting. Blocks host cap-dependent translation by binding to eIF4G, displacing MKNK1 from cap initiation complexes and preventing EIF4E phosphorylation. Binds to the tripartite leader sequence of viral late mRNAs and recruits host eIF4G, PABPC1/poly-A binding protein and 40S ribosomes subunits on viral mRNAs, allowing ribosome shunting and efficient translation of late viral mRNAs even though conventional translation via ribosome scanning from the cap has been shut off in the host cell. During assembly, acts as a chaperone protein that helps hexon proteins assembly into trimers.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039657  ;   GO:0039704  
Host cytoplasm .
DOMAIN 315 433 RRM.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available