viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L4[Gene ID: 2715920 ]
♦Pre-hexon-linking protein VIII (Pre-protein VIII) (pVIII) [Cleaved into: Hexon-linking protein-N (12.1 kDa protein VIII) (Protein VIII-N)
♦ Hexon-linking protein-C (7.6 kDa protein VIII) (Protein VIII-C)]
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKDIPTPYMWSYQPQMGLAAGASQDYSSRMNWLSAGPHMIGRVNGIRATRNQILLEQAALTSTPRRQLNPPSWPAAQVYQENPAPTTVLLPRDAEAEVQ
MTNSGAQLAGGARHVRFRDRPSPYSSGSIKRLIIRGRGIQLNDEVVSSSTGPRPDGVFQLGGAGRSSFTPRQAYLTLQSSSSQPRSGGIGTLQFVEEFVP
SVYFNPFSGAPGLYPDDFIPNYDAVSESVDGYD
233
Not Available
Not Available
01-02-1996
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Hexon-linking protein-N: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
♦ Hexon-linking protein-C: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
Not Available
♦ Hexon-linking protein-C: Virion . Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. .
♦ Pre-hexon-linking protein VIII: Host nucleus .
♦ Hexon-linking protein-N: Virion . Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available