Reviewed
Homo Sapiens (Human) [TaxID: 9606]
L4[Gene ID: 2715920 ]
♦Pre-hexon-linking protein VIII (Pre-protein VIII) (pVIII) [Cleaved into: Hexon-linking protein-N (12.1 kDa protein VIII) (Protein VIII-N)
♦ Hexon-linking protein-C (7.6 kDa protein VIII) (Protein VIII-C)]
♦ Hexon-linking protein-C (7.6 kDa protein VIII) (Protein VIII-C)]
Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus F> Human Adenovirus F Serotype 40 (HAdV-40) (Human Adenovirus 40)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSKDIPTPYMWSYQPQMGLAAGASQDYSSRMNWLSAGPHMIGRVNGIRATRNQILLEQAALTSTPRRQLNPPSWPAAQVYQENPAPTTVLLPRDAEAEVQ
MTNSGAQLAGGARHVRFRDRPSPYSSGSIKRLIIRGRGIQLNDEVVSSSTGPRPDGVFQLGGAGRSSFTPRQAYLTLQSSSSQPRSGGIGTLQFVEEFVP
SVYFNPFSGAPGLYPDDFIPNYDAVSESVDGYD
MTNSGAQLAGGARHVRFRDRPSPYSSGSIKRLIIRGRGIQLNDEVVSSSTGPRPDGVFQLGGAGRSSFTPRQAYLTLQSSSSQPRSGGIGTLQFVEEFVP
SVYFNPFSGAPGLYPDDFIPNYDAVSESVDGYD
233
Not Available
Not Available
01-02-1996
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Hexon-linking protein-N: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
♦ Hexon-linking protein-C: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
♦ Hexon-linking protein-C: Structural component of the virion that acts as a cement protein on the capsid interior and which glue the peripentonal hexons and group-of-nine hexons together.
Not Available
♦ Hexon-linking protein-C: Virion . Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. .
♦ Pre-hexon-linking protein VIII: Host nucleus .
♦ Hexon-linking protein-N: Virion . Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. .
♦ Pre-hexon-linking protein VIII: Host nucleus .
♦ Hexon-linking protein-N: Virion . Note=Located on the inner side of the capsid shell. Present in 120 copies per virion. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available