viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Early E3B 14.5 kDa protein (Early E3B 15.2 kDa glycoprotein)
Human Adenovirus B Serotype 3 (HAdV-3) (Human Adenovirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus B> Human Adenovirus B Serotype 3 (HAdV-3) (Human Adenovirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MQAMLPVILILLLPCIPLASTATRATPEQLRKCKFQQPWSFLDCYHEKSDFPTYWIVIVGIINILSCTFFSITIYPTFNFGWNSPNALGYPQEPDEHIPL
QHIQQPLALVQYENEPQPSLPPAISYFNLTGGDD
134
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Down-regulates the EGF receptor and prevents cytolysis by TNF.
Not Available
♦ Host membrane
♦ Single-pass membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available