viHumans
Reviewed
Canis Lupus Familiaris (Dog) (Canis Familiaris) [TaxID: 9615]; Homo Sapiens (Human) [TaxID: 9606]
P/V[Gene ID: 3160800 ]
Non-structural protein V
Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mammalian Rubulavirus 5> Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MDPTDLSFSPDEINKLIETGLNTVEYFTSQQVTGTSSLGKNTIPPGVTGLLTNAAEAKIQESTNHQKGSVGGGAKPKKPRPKIAIVPADDKTVPGKPIPN
PLLGLDSTPSTQTVLDLSGKTLPSGSYKGVKLAKFGKENLMTRFIEEPRENPIATSSPIDFKRGRDTGGFHRREYSIGWVGDEVKVTEWCNPSCSPITAA
ARRFECTCHQCPVTCSECERDT
222
Not Available
Not Available
01-07-1989
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays an essential role in the inhibition of host immune response. Prevents the establishment of cellular antiviral state by blocking interferon-alpha/beta (IFN-alpha/beta) production and signaling pathway. Interacts with host IFIH1/MDA5 and DHX58/LGP2 to inhibit the transduction pathway involved in the activation of IFN-beta promoter, thus protecting the virus against cell antiviral state. Efficiently blocks type I IFN signaling following infection by behaving as a substrate receptor for CUL4-DDB1 E3 ligase complex and targeting host STAT1 for proteasomal degradation.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039502  ;   GO:0039554  ;   GO:0039563  ;  
GO:0046872  
Host cytoplasm .
Not Available
Not Available
X-ray crystallography (3); NMR spectroscopy (1)
2B5L  2HYE  2K48  4I1S  
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available