Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
E1B protein, small T-antigen (E1B 19 kDa protein) (E1B-19K)
Human Adenovirus E Serotype 4 (HAdV-4) (Human Adenovirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Adenoviridae> Mastadenovirus> Human Mastadenovirus E> Human Adenovirus E Serotype 4 (HAdV-4) (Human Adenovirus 4)
Various pathway(s) in which protein is involved
Not Available
Not Available
MEIWTVLEDFHKTRQLLENASNGVSHLWRFCFGGDLAKLVYRAKQDYREQFEDILRECPSLFDALNLGHQSHFNQRISRALDFTTPGRTTAAVAFFAFIF
DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
DKWSQETHFSRDYQLDFLAVALWRTWKCQRLNAIPATCRYSR
142
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Putative adenovirus Bcl-2 homolog that inhibits apoptosis induced by TNF or FAS pathways, as well as p53-mediated apoptosis. Without E1B 19K function, virus production is compromised because of premature death of host cell. Interacts with Bax protein in cell lysates (By similarity).
Not Available
Host cell membrane . Host nucleus envelope . Host nucleus lamina . Note=Associated with the plasma and nuclear membranes, and with the insoluble nuclear lamina. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available