viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
UL46[Gene ID: 2703413 ]
Tegument protein UL46 (Tegument protein VP11/12)
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MQRRTRGASSLRLARCLTPANLIRGDNAGVPERRIFGGCLLPTPEGLLSAAVGALRQRSDDAQPAFLTCTDRSVRLAARQHNTVPESLIVDGLASDPHYE
YIRHYASAATQALGEVELPGGQLSRAILTQYWKYLQTVVPSGLDVPEDPVGDCDPSLHVLLRPTLAPKLLARTPFKSGAVAAKYAATVAGLRDALHRIQQ
YMFFMRPADPSRPSTDTALRLNELLAYVSVLYRWASWMLWTTDKHVCHRLSPSNRRFLPLGGSPEAPAETFARHLDRGPSGTTGSMQCMALRAAVSDVLG
HLTRLANLWQTGKRSGGTYGTVDTVVSTVEVLSIVHHHAQYIINATLTGYGVWATDSLNNEYLRAAVDSQERFCRTTAPLFPTMTAPSWARMELSIKAWF
GAALAADLLRNGAPSLHYESILRLVASRRTTWSAGPPPDDMASGPGGHRAGGGTCREKIQRARRDNEPPPLPRPRLHSTPASTRRFRRRRADGAGPPLPD
ANDPVAEPPAAATQPATYYTHMGEVPPRLPARNVAGPDRRPPAATCPLLVRRASLGSLDRPRVWGPAPEGEPDQMEATYLTADDDDDDARRKATHAASAR
ERHAPYEDDESIYETVSEDGGRVYEEIPWMRVYENVCVNTANAAPASPYIEAENPLYDWGGSALFSPPGRTGPPPPPLSPSPVLARHRANALTNDGPTNV
AALSALLTKLKREGRRSR
718
Not Available
Not Available
25-07-2003
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in the activation of the host PI3K/AKT pathway to promote cell survival. Interacts with and activates host LCK and thereby recruits downstream partners SHC1, GRB2 and PI3KR1 in order to activate the PI3K pathway by phosphorylating host AKT on its activating residues. This mechanism is inhibited by the viral protein US3 that instead promotes incorporation of UL46 into virions. Plays a role in the inhibition of TMEM173/STING-mediated type I interferon production (PubMed:28592536). Interacts with host DOK2 and induces its degradation. This immune evasion mechanism to inactivate T-cells may play an important role during pathogenesis (PubMed:28841444).
Not Available
GO:0006351  ;   GO:0006355  ;   GO:0016020  ;   GO:0019033  ;   GO:0020002  ;  
GO:0030430  ;   GO:0039503  
♦ Virion tegument . Host cytoplasm . Host cell membrane
♦ Peripheral membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available