Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Minor capsid protein VP2 (Minor structural protein VP2)
KI Polyomavirus (isolate Stockholm 350) (KIPyV)
Viruses> DsDNA Viruses> No RNA Stage> Polyomaviridae> Betapolyomavirus> Human Polyomavirus 3> KI Polyomavirus (isolate Stockholm 350) (KIPyV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MGIFLAVPEIIAASIAGGAEALSIAGSGAAIATGEGLAALGGITEGAALLGETIPISEAATTVLTKVPELVQATQAVTAAVQGGAGLVGGIYTALASDHP
GDLPPNTPTGSASGLHPTSGYNPQGAGLNLQSVHKPIHAPYSGMALVPIPEYQLETGIPGIPDWLFNLVASYLPELPSLQDVFNRIAFGIWSSYYNAGST
VVNRVLSDEIQRLLRDLEYGFRATLASIGESDPVNAIATQVRSLASTARERELLQITAGQPLDLSRPTSALSAAAGALTEAAYNFIYDASSLPKDGFNAL
SEGVHRLGQWISFSGPTGGTPHYATPDWILYVLEQLNADTYKIPTQAVKRKQDELHPVSPTKKANKAKKSSSPGTNSGNRSKKRRGRSTSRSTTVRRNRI
GDLPPNTPTGSASGLHPTSGYNPQGAGLNLQSVHKPIHAPYSGMALVPIPEYQLETGIPGIPDWLFNLVASYLPELPSLQDVFNRIAFGIWSSYYNAGST
VVNRVLSDEIQRLLRDLEYGFRATLASIGESDPVNAIATQVRSLASTARERELLQITAGQPLDLSRPTSALSAAAGALTEAAYNFIYDASSLPKDGFNAL
SEGVHRLGQWISFSGPTGGTPHYATPDWILYVLEQLNADTYKIPTQAVKRKQDELHPVSPTKKANKAKKSSSPGTNSGNRSKKRRGRSTSRSTTVRRNRI
400
VAR_SEQ 1 143 Missing (in isoform VP3)
Not Available
20-12-2017
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦Isoform VP2 is a structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Participates in host cell receptor binding together with VP1. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Plays a role in virion assembly within the nucleus in particular through a DNA-binding domain located in the C-terminal region. A N-terminal myristoylation suggests a scaffold function for virion assembly.
♦ Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus.
♦ Isoform VP3: structural protein that resides within the core of the capsid surrounded by 72 VP1 pentamers. Following virus endocytosis and trafficking to the endoplasmic reticulum, VP2 and VP3 form oligomers and integrate into the endoplasmic reticulum membrane. Heterooligomer VP2-VP3 may create a viroporin for transporting the viral genome across the endoplasmic reticulum membrane to the cytoplasm. Nuclear entry of the viral DNA involves the selective exposure and importin recognition of VP2 or Vp3 nuclear localization signal (shared C-terminus). Isoform VP3 plays a role in virion assembly within the nucleus.
Not Available
♦ Isoform VP2: Virion . Host endoplasmic reticulum . Host nucleus . Host endoplasmic reticulum membrane . Note=Following host cell entry, the virion enters into the endoplasmic reticulum through a calveolar-dependent pathway. Then, isoform VP2 integrates into the endoplasmic reticulum membrane and participates in the translocation of viral DNA to the nucleus. Shortly after synthesis, a nuclear localization signal directs isoform VP2 to the cell nucleus where virion assembly occurs. .
♦ Isoform VP3: Virion . Host endoplasmic reticulum . Host nucleus . Host endoplasmic reticulum membrane . Note=Following host cell entry, the virion enters into the endoplasmic reticulum through a calveolar-dependent pathway. Then, isoform VP3 integrates into the endoplasmic reticulum membrane and participates in the translocation of viral DNA to the nucleus. Shortly after synthesis, a nuclear localization signal directs isoform VP3 to the cell nucleus where virion assembly occurs. .
♦ Isoform VP3: Virion . Host endoplasmic reticulum . Host nucleus . Host endoplasmic reticulum membrane . Note=Following host cell entry, the virion enters into the endoplasmic reticulum through a calveolar-dependent pathway. Then, isoform VP3 integrates into the endoplasmic reticulum membrane and participates in the translocation of viral DNA to the nucleus. Shortly after synthesis, a nuclear localization signal directs isoform VP3 to the cell nucleus where virion assembly occurs. .
Not Available
MOTIF 359 369 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available