Reviewed
Homo Sapiens (Human) [TaxID: 9606]
1C NS1
Non-structural protein 1 (NS1) (Non-structural protein 1C)
Human Respiratory Syncytial Virus A (strain A2)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus A> Human Respiratory Syncytial Virus A (strain A2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGSNSLSMIKVRLQNLFDNDEVALLKITCYTDKLIHLTNALAKAVIHTIKLNGIVFVHVITSSDICPNNNIVVKSNFTTMPVLQNGGYIWEMMELTHCSQ
PNGLLDDNCEIKFSKKLSDSTMTNYMNQLSELLGFDLNP
PNGLLDDNCEIKFSKKLSDSTMTNYMNQLSELLGFDLNP
139
Not Available
Not Available
12-04-2017
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Plays a major role in antagonizing the type I IFN-mediated antiviral response. Acts cooperatively with NS2 to repress activation and nuclear translocation of host IFN-regulatory factor IRF-3. Interacts with host MAVS and prevents the interaction with its upstream partner DDX58/RIG-I in the signaling pathway leading to interferon production. Mediates the proteasomal degradation of host STAT2 with elongin-cullin E3 ligase. Suppresses premature apoptosis by an NF-kappa-B-dependent, interferon-independent mechanism and thus facilitates virus growth. Additionally, NS1 may serve some inhibitory role in viral transcription and RNA replication.
Not Available
Host cytoplasm . Host mitochondrion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available