viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
1C NS1
Non-structural protein 1 (NS1) (Non-structural protein 1C)
Human Respiratory Syncytial Virus A (strain A2)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus A> Human Respiratory Syncytial Virus A (strain A2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MGSNSLSMIKVRLQNLFDNDEVALLKITCYTDKLIHLTNALAKAVIHTIKLNGIVFVHVITSSDICPNNNIVVKSNFTTMPVLQNGGYIWEMMELTHCSQ
PNGLLDDNCEIKFSKKLSDSTMTNYMNQLSELLGFDLNP
139
Not Available
Not Available
12-04-2017
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a major role in antagonizing the type I IFN-mediated antiviral response. Acts cooperatively with NS2 to repress activation and nuclear translocation of host IFN-regulatory factor IRF-3. Interacts with host MAVS and prevents the interaction with its upstream partner DDX58/RIG-I in the signaling pathway leading to interferon production. Mediates the proteasomal degradation of host STAT2 with elongin-cullin E3 ligase. Suppresses premature apoptosis by an NF-kappa-B-dependent, interferon-independent mechanism and thus facilitates virus growth. Additionally, NS1 may serve some inhibitory role in viral transcription and RNA replication.
Not Available
GO:0033650  ;   GO:0039501  ;   GO:0039502  ;   GO:0039545  
Host cytoplasm . Host mitochondrion .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available