Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SH 1A
Small hydrophobic protein (Small protein 1A)
Human Respiratory Syncytial Virus A (strain A2)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Pneumoviridae> Orthopneumovirus> Human Respiratory Syncytial Virus> Human Respiratory Syncytial Virus A> Human Respiratory Syncytial Virus A (strain A2)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MENTSITIEFSSKFWPYFTLIHMITTIISLLIIISIMIAILNKLCEYNVFHNKTFELPRARVNT
64
VAR_SEQ 1 22 Missing (in isoform SHt)
Not Available
12-04-2017
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
May form a proton-selective ion channel, playing a role in budding and /or during virus entry. May also play a role in counteracting host innate immunity.
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=Present in very small amount in the virion. .
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=Present in very small amount in the virion. .
Not Available
Not Available
NMR spectroscopy (2)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available