viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Protein E8^E2C
Human Papillomavirus Type 29
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 2> Human Papillomavirus Type 29
Not Available
 
Various pathway(s) in which protein is involved
Not Available
Not Available
MAKHSTQEVPATGPLYASHNTTRSPTQAPLGPEEGQERKRRRLEAVGPGPQQQQQQQHQQQQQQQTPTHTPSTQACARTGGPVDSNRTRDCDSTSQNPYR
HPSDPDCAPVIHLRGDPNSLKCFRYRLQNGKKGLYCKASSTWRWSCEPENQSAFVTIWYTSVTQRAEFLANVKIPPGMQAILGHMSVF
188
Not Available
Not Available
18-01-2017
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Plays a role in limiting the replication of viral DNA in keratinocytes. Recruits the host NCoR/SMRT complex to viral replication foci to mediate repression of both viral replication and transcription.
Not Available
GO:0003677  ;   GO:0003700  ;   GO:0006275  ;   GO:0042025  
Host nucleus DKA0.
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available