viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
11K
Host-modulation protein 11K (Host-modulation protein of 11 kDa)
Human Parvovirus B19 (strain HV) (HPV B19)
Viruses> SsDNA Viruses> Parvoviridae> Parvovirinae> Erythroparvovirus> Primate Erythroparvovirus 1> Human Parvovirus B19 (HPV B19)> Human Parvovirus B19 (strain HV) (HPV B19)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MQNNTTGMDTKSLKNCGQPKAVCTHCKHSPPCPQPGCVTKRPPVPPRLYLPPPVPIRQPNTKDIDNVEFKYLTRYEQHVIRMLRLCNMYQNLEK
94
Not Available
Not Available
16-04-2014
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Participates in the modulation of host signaling pathways to promote viral replication and maturation.
Not Available
Host cytoplasm .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available