Reviewed
Homo Sapiens (Human) [TaxID: 9606]
BALF1[Gene ID: 3783677 ]
Apoptosis regulator BALF1
Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Gammaherpesvirinae> Lymphocryptovirus> Epstein-Barr Virus (strain GD1) (HHV-4) (Human Herpesvirus 4)
Various pathway(s) in which protein is involved
Not Available
MNLAIALDSPHPGLASYTILPRPFYHISLKPVSWPDETMRPAKSTDSVFVRTPVEAWVAPSPPDDKVAESSYLMFRAMYAVFTRDEKDLPLPALVLCRLI
KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
RRQFPVTWALASLTDFLKSL
KASLRKDRKLYAELACRTADIGGKDTHVRLIISVLRAVYNDHYDYWSRLRVVLCYTVVFAVRNYLDDHKSAAFVLGAIAHYLALYRRLWFARLGGMPRSL
RRQFPVTWALASLTDFLKSL
220
Not Available
Not Available
21-03-2012
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
May play a role in host B-cell survival by preventing host apoptosis. The survival of infected B-cells is a key step to induce host cell differentiation into memory cells, thereby assuring long term infection of the organism. May also play an active part in oncogenesis in Burkitt's lymphomy and nasopharyngeal carcinoma (By similarity).
Not Available
PANDA BPO | PANDA CCO | PANDA MFO | LocTree3 | InterProScan |
---|---|---|---|---|
-- | -- | -- | -- | -- |
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available