Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Accessory protein p12I
Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (isolate Caribbea HS-35 Subtype A) (HTLV-1)
2899128 ;
Various pathway(s) in which protein is involved
Not Available
Not Available
MLFRLLSPLSPLALTALLLFLLSPGEVSGLLLRPLPAPCLLLFLPFQILSNLLFLLFLPLFFSLPLLLSPSLPITMRFPARWRFPPWRAPSQPAAAFLF
99
VAR_SEQ 1 1 M -> MPKTRRRPRRSQRKRPPTPWQPPPFSLQGLHLAFQLSSIAINPQLLHFFFPST (in isoform p27I)
Not Available
31-05-2011
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
p12I is a modulator of T-lymphocyte proliferation and immune function and may contribute to establish a persistent infection. Binds and down-modulates cell surface expression of interleukin-2 receptors IL2RB and IL2RG. Also down-modulates cell surface MHC-I molecules by binding to free immature MHC-I heavy chains in the ER and targeting them to the proteasome for degradation. Binding to IL2RB mediates recruitment of JAK1 and JAK3. As a result of this interaction, p12I increases DNA-binding and transcriptional activity of STAT5 (By similarity).
Not Available
♦ Host endoplasmic reticulum membrane
♦ Multi-pass membrane protein . Host Golgi apparatus, host cis-Golgi network membrane
♦ Multi-pass membrane protein .
♦ Multi-pass membrane protein . Host Golgi apparatus, host cis-Golgi network membrane
♦ Multi-pass membrane protein .
Not Available
MOTIF 4 11 SH3-binding. ; MOTIF 33 38 SH3-binding. ; MOTIF 70 77 SH3-binding. ; MOTIF 88 93 SH3-binding.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available