viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
HBZ
HTLV-1 basic zipper factor (HBZ)
Human T-cell Leukemia Virus 1 (strain Japan ATK-1 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (strain Japan ATK-1 Subtype A) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MVNFVSAGLFRCLPVSCPEDLLVEELVDGLLSLEEELKDKEEEEAVLDGLLSLEEESRGRLRRGPPGEKAPPRGETHRDRQRRAEEKRKRKKEREKEEEK
QTAEYLKRKEEEKARRRRRAEKKAADVARRKQEEQERRERKWRQGAEKAKQHSARKEKMQELGIDGYTRQLEGEVESLEAERRKLLQEKEDLMGEVNYWQ
GRLEAMWLQ
209
VAR_SEQ 1 7 MVNFVSA -> MAAS (in isoform HBZ-SI)
Not Available
28-07-2009
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Contributes to the regulation of viral RNA transcription by interacting with host proteins involved in transcriptional activation such as ATF4, or CREB1, and by inhibiting their activity. Additionally, HBZ suppresses host NF-kappa-B-driven transcription mediated by host RELA as well as transcription of some classical NF-kappa-B target genes, including IL8, IL2RA, IRF4, VCAM1, and VEGFA.
Not Available
Host nucleus .
Not Available
MOTIF 87 92 Nuclear localization signal 1.; MOTIF 116 120 Nuclear localization signal 2.; MOTIF 137 141 Nuclear localization signal 3.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available