Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Non-structural protein 6 (NSP6)
Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14]) (RV-A) (Rotavirus A (isolate B4106))
Viruses> DsRNA Viruses> Reoviridae> Sedoreovirinae> Rotavirus> Rotavirus A> Rotavirus G3> Rotavirus A (isolate RVA/Human/Belgium/B4106/2000/G3P11[14]) (RV-A) (Rotavirus A (isolate B4106))
NC_011500.2 ; NC_011501.2 ; NC_011502.2 ; NC_011503.2 ; NC_011504.2 ; NC_011505.2 ; NC_011506.2 ;
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
NC_011507.2 ; NC_011508.2 ; NC_011509.2 ; NC_011510.2 ; NC_011511.2
Various pathway(s) in which protein is involved
Not Available
Not Available
MNHRQQRQLFLENLLVGMNCMFHQMQKRSINTCCQNLQKILDRLILLQTIHSPAFRLDRMQLRQMQTLACLWIHQHNHDHQVMLGAIKWISPLTKQ
96
Not Available
Not Available
14-04-2009
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Not Available
Not Available
Host cytoplasm . Host mitochondrion . Note=Found in spherical cytoplasmic structures, called viral factories, that appear early after infection and are the site of viral replication and packaging. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available