Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Large delta antigen (L-HDAg) (p27)
Hepatitis Delta Virus Genotype I (isolate Japanese M-2) (HDV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Deltavirus> Hepatitis Delta Virus (HDV)> Hepatitis Delta Virus Genotype I (isolate Japanese M-2) (HDV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSRSESKGKRAGREQILEQWVDGRKKLEELERDLRKIKKKIKKLEEENPWLGNVKGILGKKDKDGEGAPPAKRARTDQMEVDTGPRKRPLRGGFSDKERQ
DHRRRKALENKKKQLSAGGKNLSKEEEEELKRLTEEDERRERRVAGPSVGGVNPLEGGPRGAPGGGFVPNMQGVPESPFTRTGEGLDVTGNLGFPWDILF
PADPPFSPQSCRPQ
DHRRRKALENKKKQLSAGGKNLSKEEEEELKRLTEEDERRERRVAGPSVGGVNPLEGGPRGAPGGGFVPNMQGVPESPFTRTGEGLDVTGNLGFPWDILF
PADPPFSPQSCRPQ
214
Not Available
Not Available
14-04-2009
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication (By similarity).
Not Available
Virion. Host nucleus, host nucleolus. Note=isoprenylated in the cytoplasm, and translocates in the nucleus possibly after phosphorylation. Translocates after to nuclear speckle, then to the ER membrane where interaction with Hepatitis B virus antigene takes place (By similarity). .
DOMAIN 20 195 HDAg.
MOTIF 66 75 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available