viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Large delta antigen (L-HDAg) (p27)
Hepatitis Delta Virus Genotype I (isolate Japanese M-2) (HDV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Deltavirus> Hepatitis Delta Virus (HDV)> Hepatitis Delta Virus Genotype I (isolate Japanese M-2) (HDV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSRSESKGKRAGREQILEQWVDGRKKLEELERDLRKIKKKIKKLEEENPWLGNVKGILGKKDKDGEGAPPAKRARTDQMEVDTGPRKRPLRGGFSDKERQ
DHRRRKALENKKKQLSAGGKNLSKEEEEELKRLTEEDERRERRVAGPSVGGVNPLEGGPRGAPGGGFVPNMQGVPESPFTRTGEGLDVTGNLGFPWDILF
PADPPFSPQSCRPQ
214
Not Available
Not Available
14-04-2009
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Following virus entry into host cell, provides nuclear import of HDV RNPs thanks to its nuclear localization signal. Needs co-infection with hepatitis B virus to provide surface proteins, otherwise there is no packaging or budding. Packages the HDV ribonucleoprotein in hepatitis B virus empty particles. Interacts with both HDV genomic RNA and cytoplasmic tail of HBsAg. May inhibit viral RNA replication (By similarity).
Not Available
GO:0003723  ;   GO:0019012  ;   GO:0044196  ;   GO:0046718  ;   GO:0075732  
Virion. Host nucleus, host nucleolus. Note=isoprenylated in the cytoplasm, and translocates in the nucleus possibly after phosphorylation. Translocates after to nuclear speckle, then to the ER membrane where interaction with Hepatitis B virus antigene takes place (By similarity). .
DOMAIN 20 195 HDAg.
MOTIF 66 75 Nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available