viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Pan Troglodytes (Chimpanzee) [TaxID: 9598]
C
Capsid protein (Core antigen) (Core protein) (HBcAg) (p21.5)
Hepatitis B Virus Genotype B1 (isolate Japan/Ry30/2002) (HBV-B)
Viruses> Retro-transcribing Viruses> Hepadnaviridae> Orthohepadnavirus (mammalian Hepatitis B-type Viruses)> Hepatitis B Virus (HBV)> HBV Genotype B> Hepatitis B Virus Genotype B1 (isolate Japan/Ry30/2002) (HBV-B)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWVELMTLASWVGQNLQDQASRDLVVNYVNTNMGLKIRQL
LWFHISCLTFEREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIRRRGRSPRRRTPSPRRRRSQSPRRRRSQSREPQC
183
Not Available
Not Available
18-03-2008
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
♦Self assembles to form an icosahedral capsid. Most capsid appear to be large particles with a icosahedral symmetry of T=4 and consist of 240 copies of capsid protein, though a fraction forms smaller T=3 particles consisting of 180 capsid proteins. Entering capsid are transported along microtubules to the nucleus. Phosphorylation of the capsid is thought to induce exposure of nuclear localization signal in the C-terminal portion of the capsid protein that allows binding to the nuclear pore complex via the importin (karyopherin-) alpha and beta. Capsids are imported in intact form through the nuclear pore into the nuclear basket, where it probably binds NUP153. Only capsids that contain the mature viral genome can release the viral DNA and capsid protein into the nucleoplasm. Immature capsids get stucked in the basket. Capsids encapsulate the pre-genomic RNA and the P protein. Pre-genomic RNA is reverse transcribed into DNA while the capsid is still in the cytoplasm. The capsid can then either be directed to the nucleus, providing more genome for transcription, or bud through the endoplasmic reticulum to provide new virions.
♦ Encapsidates hepatitis delta genome.
Not Available
GO:0003677  ;   GO:0003723  ;   GO:0005198  ;   GO:0009405  ;   GO:0030430  ;  
GO:0039619  ;   GO:0046718  ;   GO:0075521  ;   GO:0075732  
Virion . Host cytoplasm .
Not Available
MOTIF 158 175 Bipartite nuclear localization signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available