Reviewed
Aves [TaxID: 8782]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Panthera Pardus (Leopard) (Felis Pardus) [TaxID: 9691]; Panthera Tigris (Tiger) [TaxID: 9694]; Sus Scrofa (Pig) [TaxID: 9823]
PB1
Protein PB1-F2
Influenza A Virus (strain A/Hong Kong/212/2003 H5N1 Genotype Z+)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H5N1 Subtype> Influenza A Virus (strain A/Hong Kong/212/2003 H5N1 Genotype Z+)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MEQGQDTPWTQSTEHTNIQKRGSGQQTQRLEHPSSTRLMDHYLRIMSPVGMHKQIVYWKQWLSLKNPTQGSLRTRVLKRWKLFNKQEWIN
90
Not Available
Not Available
13-11-2007
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Plays an important role in promoting lung pathology in both primary viral infection and secondary bacterial infection. Promotes alteration of mitochondrial morphology, dissipation of mitochondrial membrane potential, and cell death. Alternatively, inhibits the production of interferon in the infected cell at the level of host mitochondrial antiviral signaling MAVS. Its level of expression differs greatly depending on which cell type is infected, in a manner that is independent of the levels of expression of other viral proteins. Monocytic cells are more affected than epithelial cells. Seems to disable virus-infected monocytes or other host innate immune cells. During early stage of infection, predisposes the mitochondria to permeability transition through interaction with host SLC25A6/ANT3 and VDAC1. These proteins participate in the formation of the permeability transition pore complex (PTPC) responsible of the release of mitochondrial products that triggers apoptosis.
Not Available
Host mitochondrion inner membrane . Host nucleus . Host cytoplasm, host cytosol . Note=Inner mitochondrial membrane in most cells types. Otherwise is detected in the nucleus and cytosol. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available