viHumans
Reviewed
Aves [TaxID: 8782]; Felis Catus (Cat) (Felis Silvestris Catus) [TaxID: 9685]; Homo Sapiens (Human) [TaxID: 9606]; Panthera Pardus (Leopard) (Felis Pardus) [TaxID: 9691]; Panthera Tigris (Tiger) [TaxID: 9694]; Sus Scrofa (Pig) [TaxID: 9823]
M
Matrix protein 2 (Proton channel protein M2)
Influenza A Virus (strain A/Hong Kong/212/2003 H5N1 Genotype Z+)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Alphainfluenzavirus> Influenza A Virus> H5N1 Subtype> Influenza A Virus (strain A/Hong Kong/212/2003 H5N1 Genotype Z+)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MSLLTEVETHTRNEWECRCSDSSDPLVVAANIIGILHLILWILDRLFFKCIYRRLKYGLKRGPATAGVPESMREEYRQEQQSAVDVDDGHFVNIELE
97
Not Available
Not Available
13-11-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Forms a proton-selective ion channel that is necessary for the efficient release of the viral genome during virus entry. After attaching to the cell surface, the virion enters the cell by endocytosis. Acidification of the endosome triggers M2 ion channel activity. The influx of protons into virion interior is believed to disrupt interactions between the viral ribonucleoprotein (RNP), matrix protein 1 (M1), and lipid bilayers, thereby freeing the viral genome from interaction with viral proteins and enabling RNA segments to migrate to the host cell nucleus, where influenza virus RNA transcription and replication occur. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation.
Not Available
GO:0005216  ;   GO:0015078  ;   GO:0016021  ;   GO:0020002  ;   GO:0039521  ;  
GO:0039707  ;   GO:0044385  ;   GO:0051259  ;   GO:0055036  
♦ Virion membrane . Host apical cell membrane
♦ Single-pass type III membrane protein . Note=Abundantly expressed at the apical plasma membrane in infected polarized epithelial cells, in close proximity to budding and assembled virions. Minor component of virions (only 16-20 molecules/virion). .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available