Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
Accessory protein p30II
Human T-cell Leukemia Virus 1 (strain Japan ATK-1 Subtype A) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype A> Human T-cell Leukemia Virus 1 (strain Japan ATK-1 Subtype A) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MALCCFAFSAPCLHLRSRRSCSSCFLLATSAAFFSARLLRRAFSSSFLFKYSAVCFSSSFSRSFFRFLFSSARRCRSRCVSPRGGAFSPGGPRRSRPRLS
SSKDSKPSSTASSSSLSFNSSSKDNSPSTNSSTSRSSGHDTGKHRNSPADTKLTMLIISPLPRVWTESSFRIPSLRVWRLCTRRLVPHLWGTMFGPPTSS
RPTGHLSRASDHLGPHRWTRYRLSSTVPYPSTPLLPHPENL
SSKDSKPSSTASSSSLSFNSSSKDNSPSTNSSTSRSSGHDTGKHRNSPADTKLTMLIISPLPRVWTESSFRIPSLRVWRLCTRRLVPHLWGTMFGPPTSS
RPTGHLSRASDHLGPHRWTRYRLSSTVPYPSTPLLPHPENL
241
VAR_SEQ 1 154 Missing (in isoform p13II)
Not Available
14-11-2006
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦p30II is a multifunctional regulator that sequesters EP300/CREBBP and down-regulates CREB-responsive element (CRE) and Tax-responsive element (TRE) mediated transcription. Specifically binds and represses tax/rex mRNA nuclear export. Since Tax and Rex are positive regulators of viral gene expression, their inhibition by p30II reduces virion production, and allows the virus to escape the host immune surveillance and persist latently in an immune-competent host.
♦ p13II increases mitochondrial permeability to monovalent cations, producing a rapid, membrane potential-dependent influx of potassium. This could involve a channel-forming activity. Interferes with cell proliferation and transformation and promotes apoptosis induced by ceramide and Fas ligand, probably using the Ras signaling.
♦ p13II increases mitochondrial permeability to monovalent cations, producing a rapid, membrane potential-dependent influx of potassium. This could involve a channel-forming activity. Interferes with cell proliferation and transformation and promotes apoptosis induced by ceramide and Fas ligand, probably using the Ras signaling.
Not Available
♦ Isoform p30II: Host nucleus, host nucleolus .
♦ Isoform p13II: Host mitochondrion inner membrane .
♦ Isoform p13II: Host mitochondrion inner membrane .
Not Available
MOTIF 73 78 Nuclear localization signal 1. ; MOTIF 91 98 Nuclear localization signal 2. ; MOTIF 175 184 Mitochondrial targeting signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available