Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Tax
Protein Tax-1 (Protein X-LOR) (Trans-activating transcriptional regulatory protein of HTLV-1)
Human T-cell Leukemia Virus 1 (isolate Zaire EL Subtype B) (HTLV-1)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Deltaretrovirus> Primate T-lymphotropic Virus 1> Human T-lymphotropic Virus 1> HTLV-1 Subtype B> Human T-cell Leukemia Virus 1 (isolate Zaire EL Subtype B) (HTLV-1)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAHFPGFGQSLLFGYPVYVFGDCVQGDWCPISGGLCSARLHRHALLATCPEHQITWDPIDGRVIGSALQFLIPRLPSFPTQRTSKTLKVLTPPTTHTTPN
IPPSFLQAMRKYSPFRNGYMEPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVIFDHPDQLGAFLTNVPYKRMEELLYKISL
TTGALIILPEDCLPTTLFQPARAPVTLTAWQSGLLPFHSTLTTPGLIWAFTDGTPMISGPCPKDGRPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYS
SFHNLHLLFEEYTNIPISLLFNEKEADDTDHEPQVSPGGLEPPSEKHFRETEV
IPPSFLQAMRKYSPFRNGYMEPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVIFDHPDQLGAFLTNVPYKRMEELLYKISL
TTGALIILPEDCLPTTLFQPARAPVTLTAWQSGLLPFHSTLTTPGLIWAFTDGTPMISGPCPKDGRPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYS
SFHNLHLLFEEYTNIPISLLFNEKEADDTDHEPQVSPGGLEPPSEKHFRETEV
353
Not Available
Not Available
28-11-2006
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Transcriptional activator that activates both the viral long terminal repeat (LTR) and cellular promoters via activation of CREB, NF-kappa-B, SRF and AP-1 pathways. Binds to three 21 bp repeat elements located within the LTRs, referred to as Tax-responsive elements (TRE). Binding to TRE requires the interaction with CREB1 and CREBBP. Also induces chromatin remodeling of proviral LTR-mediated gene expression by recruiting the histone acetyl transferases CREBBP and EP300 to the chromatin, which results in histone acetylation. Via its interaction with IKK regulatory subunit IKBKG, Tax-1 persistently stimulates I-kappa-B kinase (IKK), resulting in constitutive activation of the transcription factor NF-kappa-B. Induction of the nuclear expression of members of the NFkB family of transcription factors, which leads to up-regulated expression of many gene promoters containing NFkB motifs. These genes include those encoding IL2, IL15, IL2RA and IL15RA, leading to autocrine IL2/IL2RA and IL15/IL15RA loops. The resulting T-cell proliferation leads to malignant transformation and to the development of adult T-cell leukemia (ATL). IL13, known to be linked to leukemogenesis, is also up-regulated by Tax-1. Interaction with PDZ domain-containing proteins induce IL2-independent growth, which may be a factor in multi-step leukemogenesis. Inhibits the action of at least three cellular tumor suppressors p53/TP53, RB1 and DLG1, and suppresses their abilities to dictate apoptosis in primary cells. Required for viral replication (By similarity).
Not Available
GO:0003677 ; GO:0006351 ; GO:0017124 ; GO:0030430 ; GO:0039593 ;
GO:0039645 ; GO:0039646 ; GO:0039652 ; GO:0042025 ; GO:0045893 ;
GO:0046872
GO:0039645 ; GO:0039646 ; GO:0039652 ; GO:0042025 ; GO:0045893 ;
GO:0046872
Host nucleus . Host cytoplasm . Note=Shuttles from the nucleus to the cytoplasm. Found predominantly in the nucleus, where it is equally distributed between the nucleoplasm and the nuclear matrix (By similarity). .
Not Available
MOTIF 73 80 SH3-binding. ; MOTIF 188 202 Nuclear export signal. ; MOTIF 350 353 PDZ-binding.
X-ray crystallography (3)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available