viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Vpr
Protein Vpr (Viral protein R)
Human Immunodeficiency Virus Type 2 Subtype B (isolate EHO) (HIV-2)
Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> HIV-2 Subtype B> Human Immunodeficiency Virus Type 2 Subtype B (isolate EHO) (HIV-2)
Various pathway(s) in which protein is involved
Not Available
Not Available
MAEAVPEIPPEDKNPQREPWEQWVVDVLEEIKQEALKHFDPRLLTALGNFIYNRHGNTLEGAGELIKLLQRALFLHFRGGCQHSRIGQPGGGNPLSAIPP
S
101
Not Available
Not Available
25-07-2006
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Stimulates gene expression driven by the HIV-2 LTR. Prevents infected cells from undergoing mitosis and proliferating, by inducing arrest or delay in the G2 phase of the cell cycle. Cell cycle arrest creates a favorable environment for maximizing viral expression and production (By similarity).
Not Available
GO:0006351  ;   GO:0006355  ;   GO:0007049  ;   GO:0019012  ;   GO:0039592  ;  
GO:0042025  ;   GO:0046718  ;   GO:0075732  
Virion. Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available