Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
NS
Nuclear export protein (NEP) (Non-structural protein 2) (NS2) (Fragment)
Influenza C Virus (strain C/Yamagata/10/1981)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/Yamagata/10/1981)
NC_006307.2 ; AB126193.2 ; NC_006308.2 ; AB126196.2 ; NC_006309.2 ; AB126191.2 ; NC_006310.2 ;
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
AB283001.1 ; NC_006311.1 ; AB126195.1 ; NC_006312.2 ; AB126191.2 ; NC_006306.2 ; AB283001.1
Various pathway(s) in which protein is involved
Not Available
Not Available
VKSTNLMAFVATKMLERQEDLDTCTEMQVEKMKASTKARLRTESSFAPRTWEDAIKDEILRRSVDTSSLDRWPELKQELENVSDALKADSLWLPMKSLSL
YSEVSNQEPSSIPIGEMKHQILTRLKLICSRLEKLDHNLSKAVLGIQNSEDLILIIYNRDICKNTILMIKSLCNSLI
YSEVSNQEPSSIPIGEMKHQILTRLKLICSRLEKLDHNLSKAVLGIQNSEDLILIIYNRDICKNTILMIKSLCNSLI
177
Not Available
Not Available
21-02-2006
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Mediates the nuclear export of encapsidated genomic RNAs (ribonucleoproteins, RNPs). Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs to which the M1 protein is bound. Because the M1 protein is not available in large quantities until the later stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the nucleus before sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enters the cytoplasm only when they have associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced (By similarity).
Not Available
Virion . Host nucleus .
Not Available
MOTIF 91 100 Nuclear export signal. ; MOTIF 117 127 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available