Reviewed
Homo Sapiens (Human) [TaxID: 9606]
M
Matrix protein 2 (BM2)
Influenza B Virus (strain B/Yamagata/1/1973)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Betainfluenzavirus> Influenza B Virus> Influenza B Virus (strain B/Yamagata/1/1973)
NC_002205.1 ; AF102017.1 ; NC_002206.1 ; AF102017.1 ; NC_002207.1 ; M14880.1 ; NC_002208.1 ;
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
Various pathway(s) in which protein is involved
Not Available
Not Available
MLEPFQILSICSFILSALHFMGWTIGHLNQIKRGVNLKIRIRNPNKETINREVSILRHSYQKEIQAKETIKEVLSDNMERLSDHIVIEGLSAEEIIKMGE
TVLEVEELH
TVLEVEELH
109
Not Available
Not Available
10-01-2006
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Forms presumably a highly low-pH gated proton-selective channel. Trp-23 may function as a minimalistic gate that opens and closes the pore. When the environmental pH is lower than a threshold, the BM2 channel would be activated and selectively transport protons across the membrane from the extracellular side to the cytoplasmic side. Crucial for the uncoating process. When the virion is internalized into the endosome, the channel acidifies the virion's interior, promoting the dissociation of matrix protein 1 (M1) from the ribonucleoprotein (RNP) thus allowing the transport of the RNP from the virion into the cell's nucleus. Also plays a role in viral proteins secretory pathway. Elevates the intravesicular pH of normally acidic compartments, such as trans-Golgi network, preventing newly formed hemagglutinin from premature switching to the fusion-active conformation (By similarity). Plays a crucial role in virion assembly. Expressed in the late phase of the infection.
Not Available
GO:0005216 ; GO:0016021 ; GO:0020002 ; GO:0039707 ; GO:0044385 ;
GO:0051259 ; GO:0055036 ; GO:1902600
GO:0051259 ; GO:0055036 ; GO:1902600
♦ Virion membrane
♦ Single-pass type III membrane protein . Host cell membrane
♦ Single-pass type III membrane protein . Note=Transported to the plasma membrane through the trans Golgi network. .
♦ Single-pass type III membrane protein . Host cell membrane
♦ Single-pass type III membrane protein . Note=Transported to the plasma membrane through the trans Golgi network. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available