viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
F protein (Alternate reading frame protein/F-protein) (ARFP/F) (Frameshifted protein) (p16) (p17)
Hepatitis C Virus Genotype 1a (isolate 1) (HCV)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Flaviviridae> Hepacivirus> Hepacivirus C> Hepatitis C Virus Genotype 1> Hepatitis C Virus Subtype 1a> Hepatitis C Virus Genotype 1a (isolate 1) (HCV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSTNPKPQKKKTNVTPTVAHRTSSSRVAVRSLVEFTCCRAGALDWVCARRERLPSGRNLEVDVSLSPRLVGPRAGPGLSPGTLGPSMAMRAAGGRDGSCL
PVALGLAGAPQTPGVGRAIWVRSSIPLRAASPTSWGTYRSSAPLLEALPGPWRMASGFWKTA
162
Not Available
Not Available
23-01-2007
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Host cytoplasm . Host cytoplasm, host perinuclear region .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available