viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US9[Gene ID: 3077455 ]
Unique short US9 glycoprotein (Protein HXLF3) (gpUS9)
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASSSSRICPLSNSKSVRLPQYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSD
TAPRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRSVLHCRPASRLPWLPLRVTPSDLERLFAERRYLTFLYVVLV
QFVKHVALFSFGVQVACCVYLRWIRPWVRGRHRATGRTSREEEAKDD
247
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Influences cell-to-cell spread of virus in polarized cells. Promotes dissemination of virus across cell-cell junctions of polarized epithelial cells, maybe through the association with the cytoskeletal matrix.
Not Available
GO:0016021  ;   GO:0030683  ;   GO:0044163  ;   GO:0044178  ;   GO:0044386  
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein. Host cytoplasm, host cytoskeleton. Host Golgi apparatus membrane
♦ Single-pass type I membrane protein. Note=In polarized cells, colocalizes with F-actin in the cortical cytoskeleton which underlies lateral membranes.
DOMAIN 72 168 Ig-like H-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available