Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US9[Gene ID: 3077455 ]
Unique short US9 glycoprotein (Protein HXLF3) (gpUS9)
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MILWSPSTCSFFWHWCLIAVSVLSSRSKESLRLSWSSDESSASSSSRICPLSNSKSVRLPQYPRGFGDVSGYRVSSSVSECYVQHGVLVAAWLVRGNFSD
TAPRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRSVLHCRPASRLPWLPLRVTPSDLERLFAERRYLTFLYVVLV
QFVKHVALFSFGVQVACCVYLRWIRPWVRGRHRATGRTSREEEAKDD
TAPRAYGTWGNERSATHFKVGAPQLENDGALRYETELPQVDARLSYVMLTVYPCSACNRSVLHCRPASRLPWLPLRVTPSDLERLFAERRYLTFLYVVLV
QFVKHVALFSFGVQVACCVYLRWIRPWVRGRHRATGRTSREEEAKDD
247
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Influences cell-to-cell spread of virus in polarized cells. Promotes dissemination of virus across cell-cell junctions of polarized epithelial cells, maybe through the association with the cytoskeletal matrix.
Not Available
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein. Host cytoplasm, host cytoskeleton. Host Golgi apparatus membrane
♦ Single-pass type I membrane protein. Note=In polarized cells, colocalizes with F-actin in the cortical cytoskeleton which underlies lateral membranes.
♦ Single-pass type I membrane protein. Host cytoplasm, host cytoskeleton. Host Golgi apparatus membrane
♦ Single-pass type I membrane protein. Note=In polarized cells, colocalizes with F-actin in the cortical cytoskeleton which underlies lateral membranes.
DOMAIN 72 168 Ig-like H-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available