Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US3
Membrane glycoprotein US3 (Glycoprotein E) (Protein HQLF1) (gpUS3 IE)
Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Betaherpesvirinae> Cytomegalovirus> Human Cytomegalovirus (HHV-5) (Human Herpesvirus 5)> Human Cytomegalovirus (strain AD169) (HHV-5) (Human Herpesvirus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
MKPVLVLAILAVLFLRLADSVPRPLDVVVSEIRSAHFRVEENQCWFHMGMLYFKGRMSGNFTEKHFVNVGIVSQSYMDRLQVSGEQYHHDERGAYFEWNI
GGHPVTHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI
GGHPVTHTVDMVDITLSTRWGDPKKYAACVPQVRMDYSSQTINWYLQRSMRDDNWGLLFRTLLVYLFSLVVLVLLTVGVSARLRFI
186
Not Available
Not Available
01-07-1989
Evidence at transcript level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Retains, but does not degrade MHC class I heterodimers in the endoplasmic reticulum during the immediate-early period of virus infection, thereby impairing their transport and maturation. Forms a complex with beta-2-microglobulin-associated class I heavy chains, which accumulate in the ER. In consequence, infected cells are masked for immune recognition by cytotoxic T-lymphocytes.
Not Available
♦ Host endoplasmic reticulum membrane
♦ Single-pass type I membrane protein .
♦ Single-pass type I membrane protein .
DOMAIN 35 133 Ig-like H-type.
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available