Reviewed
Cervidae (deer) [TaxID: 9850]; Homo Sapiens (Human) [TaxID: 9606]; Ochlerotatus Triseriatus (Eastern Treehole Mosquito) (Aedes Triseriatus) [TaxID: 7162]; Tamias [TaxID: 13712]
N
Non-structural protein NS-S (Fragment)
Bunyavirus La Crosse (isolate Aedes Triseriatus/United States/L74/1974)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Bunyavirales> Peribunyaviridae> Orthobunyavirus> California Encephalitis Orthobunyavirus> Bunyavirus La Crosse> Bunyavirus La Crosse (isolate Aedes Triseriatus/United States/L74/1974)
Various pathway(s) in which protein is involved
Not Available
Not Available
MMSHQQVQINLILMQGIWTSVLKMQNHSTLLQLGSSSTMPQRPRLLS
47
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Inhibits host transcriptional machinery, by producing modifications to the phosphorylation state of the C-terminal domain (CTD) of RNA polymerase II. Inhibits phosphorylation at serine 2 in the heptapeptide repeat (YSPTSPS) of the CTD of RNA polymerase II, suggesting that the elongation step of transcription and/or 3'-end processing is prevented. Inhibition of host transcription machinery leads to shut off of host cell protein synthesis and inhibition of the host innate immune response. NSs also seems to be involved in the nuclear relocalization of host PABP1 (By similarity).
Not Available
Not Available
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available