viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF65[Gene ID: 1487702 ]
Envelope protein US9 (Envelope protein 65) (ORF65 protein)
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MAGQNTMEGEAVALLMEAVVTPRAQPNNTTITAIQPSRSAEKCYYSDSENETADEFLRRIGKYQHKIYHRKKFCYITLIIVFVFAMTGAAFALGYITSQF
VG
102
Not Available
Not Available
01-07-1989
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Essential for the anterograde spread of the infection throughout the host nervous system. Together with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0020002  ;   GO:0044178  ;   GO:0055036  ;  
GO:0075733  
♦ Virion membrane
♦ Single-pass type II membrane protein . Host Golgi apparatus membrane
♦ Single-pass type II membrane protein . Host Golgi apparatus, host trans-Golgi network . Host cell membrane
♦ Single-pass type II membrane protein . Note=During virion morphogenesis, this protein accumulates in the trans-Golgi where secondary envelopment occurs. .
Not Available
MOTIF 14 15 Di-leucine internalization motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available