viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
64; 69[Gene ID: 1487701;1487710 ]
Virion protein US10 homolog (Genes 64/69 protein)
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MNLCGSRGEHPGGEYAGLYCTRHDTPAHQALMNDAERYFAAALCAISTEAYEAFIHSPSERPCASLWGRAKDAFGRMCGELAADRQRPPSVPPIRRAVLS
LLREQCMPDPQSHLELSERLILMAYWCCLGHAGLPTIGLSPDNKCIRAELYDRPGGICHRLFDAYLGCGSLGVPRTYERS
180
Not Available
Not Available
01-07-1989
Evidence at transcript level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
Virion tegument . Host nucleus matrix .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available