Reviewed
Homo Sapiens (Human) [TaxID: 9606]
SCP 23
Small capsomere-interacting protein
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MTQPASSRVVFDPSNPTTFSVEAIAAYTPVALIRLLNASGPLQPGHRVDIADARSIYTVGAAASAARARANHNANTIRRTAMFAETDPMTWLRPTVGLKR
TFNPRIIRPQPPNPSMSLGISGPTILPQKTQSADQSALQQPAALAFSGSSPQHPPPQTTSASVGQQQHVVSGSSGQQPQQGAQSSTVQPTTGSPPAAQGV
PQSTPPPTQNTPQGGKGQTLSHTGQSGNASRSRRV
TFNPRIIRPQPPNPSMSLGISGPTILPQKTQSADQSALQQPAALAFSGSSPQHPPPQTTSASVGQQQHVVSGSSGQQPQQGAQSSTVQPTTGSPPAAQGV
PQSTPPPTQNTPQGGKGQTLSHTGQSGNASRSRRV
235
Not Available
Not Available
01-07-1989
Inferred from homology
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
♦Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the capsid protein VP5 and VP26 assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly (By similarity).
♦ Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.
♦ Participates in the assembly of the infectious particles by decorating the outer surface of the capsid shell and thus forming a layer between the capsid and the tegument. Complexes composed of the major capsid protein and small capsomere-interacting protein/SCP assemble together in the host cytoplasm and are translocated to the nucleus, where they accumulate and participate in capsid assembly.
Not Available
Virion . Host nucleus , .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available