viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
ORF1
Structural protein 1 (Structural ORF1 protein)
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSRVSEYGVPEGVRESDSDTDSVFMYQHTELMQNNASPLVVQTRPPAVLIPLVDVPRPRSRRKASAQLKMQMDRLCNVLGVVLQMATLALVTYIAFVVHT
RATSCKRE
108
Not Available
Not Available
01-07-1989
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Not Available
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Host Golgi apparatus membrane
♦ Single-pass type II membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available