Reviewed
Homo Sapiens (Human) [TaxID: 9606]
66[Gene ID: 1487703 ]
Serine/threonine-protein kinase US3 homolog (Protein kinase ORF66) (EC 2.7.11.1)
Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Varicellovirus> Human Herpesvirus 3 (HHV-3) (Varicella-zoster Virus)> Varicella-zoster Virus (strain Dumas) (HHV-3) (Human Herpesvirus 3)
Various pathway(s) in which protein is involved
Not Available
MNDVDATDTFVGQGKFRGAISTSPSHIMQTCGFIQQMFPVEMSPGIESEDDPNYDVNMDIQSFNIFDGVHETEAEASVALCAEARVGINKAGFVILKTFT
PGAEGFAFACMDSKTCEHVVIKAGQRQGTATEATVLRALTHPSVVQLKGTFTYNKMTCLILPRYRTDLYCYLAAKRNLPICDILAIQRSVLRALQYLHNN
SIIHRDIKSENIFINHPGDVCVGDFGAACFPVDINANRYYGWAGTIATNSPELLARDPYGPAVDIWSAGIVLFEMATGQNSLFERDGLDGNCDSERQIKL
IIRRSGTHPNEFPINPTSNLRRQYIGLAKRSSRKPGSRPLWTNLYELPIDLEYLICKMLSFDARHRPSAEVLLNHSVFQTLPDPYPNPMEVGD
PGAEGFAFACMDSKTCEHVVIKAGQRQGTATEATVLRALTHPSVVQLKGTFTYNKMTCLILPRYRTDLYCYLAAKRNLPICDILAIQRSVLRALQYLHNN
SIIHRDIKSENIFINHPGDVCVGDFGAACFPVDINANRYYGWAGTIATNSPELLARDPYGPAVDIWSAGIVLFEMATGQNSLFERDGLDGNCDSERQIKL
IIRRSGTHPNEFPINPTSNLRRQYIGLAKRSSRKPGSRPLWTNLYELPIDLEYLICKMLSFDARHRPSAEVLLNHSVFQTLPDPYPNPMEVGD
393
Not Available
Not Available
01-07-1989
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Multifunctional serine/threonine kinase that plays a role in several processes including egress of virus particles from the nucleus, modulation of the actin cytoskeleton and inhibition of apoptosis. Phosphorylates proteins 24 and 27, two critical regulators of capsid budding from nucleus to endoplasmic reticulum, thereby facilitating virion egress. Modulates and redistributes host components of the nuclear envelope, including LMNA, emerin/EMD and the nuclear matrix protein MATR3. Phosphorylates envelope glycoprotein B (gB), probably to direct it to the cell surface. Promotes virus intracellular spread by restructuring host cell cytoskeleton. Blocks host apoptosis to extend cell survival and allow efficient viral replication. Promotes viral gene expression by phosphorylating host HDAC2 to reduce viral genome silencing (By similarity). Downregulates class I major histocompatibility complex (MHC-I) surface expression. Additionally, phosphorylates IE62 and targets it to the cytoplasm. The nuclear exclusion of IE62 enables the packaging of abundant levels of IE62 into virions.
2.7.11.1
GO:0004674 ; GO:0005524 ; GO:0030430 ; GO:0039504 ; GO:0039525 ;
GO:0039526 ; GO:0042025 ; GO:0046776
GO:0039526 ; GO:0042025 ; GO:0046776
Host cytoplasm . Host nucleus .
DOMAIN 93 378 Protein kinase.
Not Available
Predicted/Modelled
Not Available
ACT_SITE 206 206 Proton acceptor.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available