viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
Not Available
♦Genome polyprotein [Cleaved into: Protein 3B (P3B) (VPg)
♦ Picornain 3C (EC 3.4.22.28) (Protease 3C) (P3C)] (Fragment)
Echo 9 Virus (EV-9) (Coxsackievirus A23)
Viruses> SsRNA Viruses> SsRNA Positive-strand Viruses> No DNA Stage> Picornavirales> Picornaviridae> Enterovirus> Enterovirus B> Echo 9 Virus (EV-9) (Coxsackievirus A23)
Not Available
Various pathway(s) in which protein is involved
Not Available
Not Available
GAYTGMPNKKPKVPTLRQAKVQGPAFEFAVAMMKRNASTVKTEYGEFTMLGIYDRWAVLPRHAKPGPSILMNDQEVGVLDAKELVDKDGINLELTLLKLN
RNEKFRDIRGFLAREEVEVNEAVLAINTSKFPNMYIPVGQVTDYGFLNLGGTPTKRMLMYNFPTRAGQCGGVLMSTGKVLGIHVGGNGHHGFSAALLRHY
FNEEQ
205
Not Available
Not Available
01-08-1988
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Protease 3C: cysteine protease that generates mature viral proteins from the precursor polyprotein. In addition to its proteolytic activity, it binds to viral RNA, and thus influences viral genome replication. RNA and substrate bind cooperatively to the protease (By similarity).
3.4.22.28  
GO:0003723  ;   GO:0004197  ;   GO:0018144  ;   GO:0019012  ;   GO:0019062  ;  
GO:0030430  ;   GO:0046718  
♦ Protein 3B: Virion .
♦ Picornain 3C: Host cytoplasm .
DOMAIN 23 188 Peptidase C3.
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 62 62 For picornain 3C activity.
♦ ACT_SITE 93 93 For picornain 3C activity.
♦ ACT_SITE 169 169 For picornain 3C activity.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available