Reviewed
Homo Sapiens (Human) [TaxID: 9606]
NS
Nuclear export protein (NEP) (Non-structural protein 2) (NS2)
Influenza B Virus (strain B/Yamagata/1/1973)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Betainfluenzavirus> Influenza B Virus> Influenza B Virus (strain B/Yamagata/1/1973)
NC_002205.1 ; AF102017.1 ; NC_002206.1 ; AF102017.1 ; NC_002207.1 ; M14880.1 ; NC_002208.1 ;
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
K01395.1 ; NC_002209.1 ; J02095.1 ; NC_002210.1 ; AF101982.1 ; NC_002211.1 ; K00423.1 ;
RNA 1:NC_002204.1 ; M14880.1
Various pathway(s) in which protein is involved
Not Available
Not Available
MADNMTTTQIEWRMKKMAIGSSTHSSSVLMKDIQSQFEQLKLRWESYPNLVKSTDYHQRRETIRLVTEELYLLSKRIDDNILFHKTVIANSSIIADMIVS
LSLLETLYEMKDVVEVYSRQCL
LSLLETLYEMKDVVEVYSRQCL
122
Not Available
Not Available
01-08-1988
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Mediates the nuclear export of encapsidated genomic RNAs (ribonucleoproteins, RNPs). Acts as an adapter between viral RNPs complexes and the nuclear export machinery of the cell. Possesses no intrinsic RNA-binding activity, but includes a C-terminal M1-binding domain. This domain is believed to allow recognition of RNPs bound to the protein M1. Since protein M1 is not available in large quantities before late stages of infection, such an indirect recognition mechanism probably ensures that genomic RNPs are not exported from the host nucleus until sufficient quantities of viral mRNA and progeny genomic RNA have been synthesized. Furthermore, the RNPs enter the host cytoplasm only when associated with the M1 protein that is necessary to guide them to the plasma membrane. May down-regulate viral RNA synthesis when overproduced.
Not Available
Virion . Host nucleus .
Not Available
MOTIF 10 19 Nuclear export signal. ; MOTIF 86 95 Nuclear export signal.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available