viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
HE
♦Hemagglutinin-esterase-fusion glycoprotein (HEF) (EC 3.1.1.53) [Cleaved into: Hemagglutinin-esterase-fusion glycoprotein chain 1 (HEF1)
♦ Hemagglutinin-esterase-fusion glycoprotein chain 2 (HEF2)] (Fragment)
Influenza C Virus (strain C/Pig/Beijing/439/1982)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/Pig/Beijing/439/1982)
Various pathway(s) in which protein is involved
Not Available
Not Available
AEKIKICLQKQVNSSFSLHNGFGGNLYATEEKRMFELVKPKAGASVLNQSTWICFGDSRTDQSNSAFPRSADVSAKTAEKFRSLSGGSLMLSMFGPPGKV
DYLYQGCGKHKVFYEGVNWSPHTAIDCYRKNWTDIKLNFQKSIYELASQSHCMSLVNALDKTIPLQATKGVAKNCNNSFLKNPALYTQEVKPLDQICGEE
NLAFFTLPTQFGTYECKLHLVASCYFIYDSKEVYNKRGCGNYFQVIYDSSGKVVGGLDNRVSPYTGNSGDTPTMQCDMLQLKPGRYSVRSSPRFLLMPER
SYCFDMKEKGLVTAVQSIWGKGRKSDYAVDQACLSTPGCMLIQKQKPYIGEADDHHGDQEMRELLSGLDYEARCISQSGWVNETSPFTEEYLLPPKFGRC
PLAAKEESIPKIPDGLLIPTSGTDTTVTKPKSRIFGIDDLIIGLFFVAIVEAGIGGYLLGSRKESGGGVTKESAEKGFEKIGNDIQILRSSTNIAIEKLN
DRISHDEQAIRDLTLEIENARSEALLGELGIIRALLVGNISIGLQESLWELASEITNRAGDLAVEVSPGCWIIDNNICDQSCQNFIFKFNETAPVPTIPP
LDTKIDLQSDPFYWGSSLGLAITTPISLAALVISGIAICRTK
642
Not Available
Not Available
01-08-1988
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Binds to the N-acetyl-9-O-acetylneuraminic acid residues on the cell surface, bringing about the attachment of the virus particle to the cell. Plays a major role in the determination of host range restriction and virulence. Class I viral fusion protein. Responsible for penetration of the virus into the cell cytoplasm by mediating the fusion of the membrane of the endocytosed virus particle with the endosomal membrane. Low pH in endosomes induce an irreversible conformational change in HEF2, releasing the fusion hydrophobic peptide. Several trimers are required to form a competent fusion pore. Displays a receptor-destroying activity which is a neuraminidate-O-acetyl esterase. This activity cleaves off any receptor on the cell surface, which would otherwise prevent virions release. These cleavages prevent self-aggregation and ensure the efficient spread of the progeny virus from cell to cell (By similarity).
3.1.1.53  
GO:0001681  ;   GO:0016021  ;   GO:0019031  ;   GO:0019062  ;   GO:0019064  ;  
GO:0020002  ;   GO:0039654  ;   GO:0046789  ;   GO:0055036  
♦ Virion membrane
♦ Single-pass type I membrane protein . Host cell membrane
♦ Single-pass type I membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
♦ACT_SITE 58 58 Nucleophile.
♦ ACT_SITE 353 353 Charge relay system.
♦ ACT_SITE 356 356 Charge relay system.
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available