viHumans
Reviewed
Canis Lupus Familiaris (Dog) (Canis Familiaris) [TaxID: 9615]; Homo Sapiens (Human) [TaxID: 9606]
SH[Gene ID: 3160797 ]
Small hydrophobic protein
Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Paramyxoviridae> Rubulavirus> Mammalian Rubulavirus 5> Parainfluenza Virus 5 (strain W3) (PIV5) (Simian Virus 5)
Not Available
Various pathway(s) in which protein is involved
Not Available
MLPDPEDPESKKATRRAGNLIICFLFIFFLFVTFIVPTLRHLLS
44
Not Available
Not Available
01-04-1988
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Inhibits TNF-alpha signaling and seems to block apoptosis in host infected cells.
Not Available
♦ Virion membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available