viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]; Sus Scrofa (Pig) [TaxID: 9823]
NS
Non-structural protein 1 (NS1) (NS1A)
Influenza C Virus (strain C/California/1978)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Orthomyxoviridae> Gammainfluenzavirus> Influenza C Virus> Influenza C Virus (strain C/California/1978)
Various pathway(s) in which protein is involved
Not Available
Not Available
MSDKTVKSTNLMAFVATKMLERQEDLDTCTEMQVEKMKTSTKARLRTESSFAPRTWEDAIKDGELLFNGTILQAESTTMTPASVEMKGKKFPIDFVPSNI
APIGQNPIYLSPCIPNFDGNVWEATMYHHRGATLTKTMNCNCFQRTIWCHPNPSRMRLSYAFVLYCRNTKKICGYLIAKQVAGIETGIRKCFRCIKSGFV
MATDEISLIILQSIKSGAQLDPYWGNETPDIDKTEAYMLSLREAGP
246
Not Available
Not Available
21-02-2006
Inferred from homology
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Prevents the establishment of the cellular antiviral state initiated by host DDX58, which normally triggers the antiviral transduction signal that leads to the activation of type I IFN genes by transcription factors IRF3 and IRF7. Participates also in the upregulation of the splicing of viral mRNAs.
Not Available
GO:0003723  ;   GO:0030430  ;   GO:0039502  ;   GO:0039540  ;   GO:0042025  
Host cytoplasm . Host nucleus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available