Reviewed
Homo Sapiens (Human) [TaxID: 9606]
E5[Gene ID: 1489077 ]
Probable protein E5
Human Papillomavirus Type 16
Viruses> DsDNA Viruses> No RNA Stage> Papillomaviridae> Alphapapillomavirus> Alphapapillomavirus 9> Human Papillomavirus Type 16
Various pathway(s) in which protein is involved
Not Available
MTNLDTASTTLLACFLLCFCVLLCVCLLIRPLLLSVSTYTSLIILVLLLWITAASAFRCFIVYIIFVYIPLFLIHTHARFLIT
83
Not Available
Not Available
01-10-1989
Evidence at protein level
| Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
|---|---|---|---|---|---|
| Alanine (A) | Leucine (L) | ||||
| Arginine (R) | Lysine (K) | ||||
| Asparagine (N) | Methionine (M) | ||||
| Aspartic Acid (D) | Phenylalanine (F) | ||||
| Cysteine (C) | Proline (P) | ||||
| Glutamine (Q) | Serine (S) | ||||
| Glutamic Acid (E) | Threonine (T) | ||||
| Glycine (G) | Tryptophan (W) | ||||
| Histidine (H) | Tyrosine (Y) | ||||
| Isoleucine (I) | Valine (V) |
| % Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
|---|---|---|
Acts to keep host cells in a proliferation-competent state upon differentiation. Enhances host epidermal growth factor receptor (EGFR) activation after stimulation by EGF by inhibiting EGFR internalization. Induces a redistribution of host caveolin-1 and glycosphingolipid (ganglioside GM1) components of lipid rafts to the plasma membrane. Since GM1s inhibit cytotoxic T-lymphocytes, block immune synapse formation, and enhance proliferative signaling by the EGFR, E5 may enhance immune evasion and cell proliferation via a common mechanism. E5 also alters endosomal pH by interacting with the vacuolar H+-ATPase, which is a proton pump responsible for acidifying cellular organelles. Additionally, E5 prevents transport of the major histocompatibility class I to the cell surface and retains the complex in the Golgi apparatus.
Not Available
GO:0016021 ; GO:0019048 ; GO:0020002 ; GO:0033668 ; GO:0039504 ;
GO:0044167 ; GO:0044177 ; GO:0046776 ; GO:0072657
GO:0044167 ; GO:0044177 ; GO:0046776 ; GO:0072657
♦ Host membrane
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane . Host Golgi apparatus .
♦ Multi-pass membrane protein . Host endoplasmic reticulum membrane . Host Golgi apparatus .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available