Reviewed
Homo Sapiens (Human) [TaxID: 9606]
GI US7[Gene ID: 2703446 ]
Envelope glycoprotein I (gI)
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MPCRPLQGLVLVGLWVCATSLVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYPMGHKCPRVVHVVTVTACPRR
PAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRDYAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY
QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATRATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQ
RRYRRSRRPIYSPQMPTGISCAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPTTPTPTPPLLV
PAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRDYAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY
QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATRATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQ
RRYRRSRRPIYSPQMPTGISCAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPTTPTPTPPLLV
390
Not Available
Not Available
01-01-1988
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
♦In epithelial cells, the heterodimer gE/gI is required for the cell-to-cell spread of the virus, by sorting nascent virions to cell junctions. Once the virus reaches the cell junctions, virus particles can spread to adjacent cells extremely rapidly through interactions with cellular receptors that accumulate at these junctions. Implicated in basolateral spread in polarized cells. In neuronal cells, gE/gI is essential for the anterograde spread of the infection throughout the host nervous system. Together with US9, the heterodimer gE/gI is involved in the sorting and transport of viral structural components toward axon tips.
♦ The heterodimer gE/gI serves as a receptor for the Fc part of human IgG. Dissociation of gE/gI from IgG occurs at acidic pH. May thus be involved in anti-HSV antibodies bipolar bridging, followed by intracellular endocytosis and degradation, thereby interfering with host Ig-mediated immune responses.
♦ The heterodimer gE/gI serves as a receptor for the Fc part of human IgG. Dissociation of gE/gI from IgG occurs at acidic pH. May thus be involved in anti-HSV antibodies bipolar bridging, followed by intracellular endocytosis and degradation, thereby interfering with host Ig-mediated immune responses.
Not Available
♦ Virion membrane
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host cell junction , . Host Golgi apparatus, host trans-Golgi network . Note=During virion morphogenesis, this protein probably accumulates in the trans-Golgi where secondary envelopment occurs. The heterodimer gE/gI then redistributes to cell junctions to promote cell-cell spread later in the infection. .
♦ Single-pass membrane protein . Host cell membrane
♦ Single-pass type I membrane protein . Host cell junction , . Host Golgi apparatus, host trans-Golgi network . Note=During virion morphogenesis, this protein probably accumulates in the trans-Golgi where secondary envelopment occurs. The heterodimer gE/gI then redistributes to cell junctions to promote cell-cell spread later in the infection. .
Not Available
Not Available
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.