viHumans
Reviewed
Homo Sapiens (Human) [TaxID: 9606]
US9[Gene ID: 2703452 ]
Envelope protein US9 (10 kDa protein)
Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Viruses> DsDNA Viruses> No RNA Stage> Herpesvirales> Herpesviridae> Alphaherpesvirinae> Simplexvirus> Human Herpesvirus 1 (HHV-1) (Human Herpes Simplex Virus 1)> Human Herpesvirus 1 (strain 17) (HHV-1) (Human Herpes Simplex Virus 1)
Not Available
Various pathway(s) in which protein is involved
Not Available
MTSRLSDPNSSARSDMSVPLYPTASPVSVEAYYSESEDEAANDFLVRMGRQQSVLRRRRRRTRCVGMVIACLLVAVLSGGFGALLMWLLR
90
Not Available
Not Available
01-01-1988
Evidence at protein level
Amino Acid Count % Frequency Amino Acid Count % Frequency
Alanine (A) Leucine (L)
Arginine (R) Lysine (K)
Asparagine (N) Methionine (M)
Aspartic Acid (D) Phenylalanine (F)
Cysteine (C) Proline (P)
Glutamine (Q) Serine (S)
Glutamic Acid (E) Threonine (T)
Glycine (G) Tryptophan (W)
Histidine (H) Tyrosine (Y)
Isoleucine (I) Valine (V)
% Number of Residues in Helices % Number of Residues in Strands % Number of Residues in Coils
Essential for the anterograde spread of the infection throughout the host nervous system. Together with the gE/gI heterodimer, US9 is involved in the sorting and transport of viral structural components toward axon tips.
Not Available
GO:0016021  ;   GO:0019031  ;   GO:0020002  ;   GO:0044171  ;   GO:0044178  ;  
GO:0055036  ;   GO:0075733  
♦ Virion membrane
♦ Single-pass type II membrane protein. Host Golgi apparatus membrane
♦ Single-pass type II membrane protein. Host smooth endoplasmic reticulum membrane
♦ Single-pass type II membrane protein . Host cell membrane
♦ Single-pass type II membrane protein . Note=During virion morphogenesis, this protein probably accumulates in the endosomes and trans-Golgi where secondary envelopment occurs. It is probably transported to the cell surface from where it is endocytosed and directed to the trans-Golgi network (TGN), maybe through an interaction with PACS-1 sorting protein (Potential). .
Not Available
MOTIF 21 24 Internalization motif.
Predicted/Modelled
Not Available
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
Virtual screening has been performed using RASPD
  • Million Molecules

Best 20 Hit molecules

    Not Available