Reviewed
Aedes [TaxID: 7158]; Bos Taurus (Bovine) [TaxID: 9913]; Culicoides [TaxID: 58271]; Equus Asinus (Donkey) (Equus Africanus Asinus) [TaxID: 9793]; Equus Caballus (Horse) [TaxID: 9796]; Homo Sapiens (Human) [TaxID: 9606]; Lutzomyia [TaxID: 252607]; Musca Domestica (House Fly) [TaxID: 7370]; Simuliidae (black Flies) [TaxID: 7190]; Sus Scrofa (Pig) [TaxID: 9823]
P
Phosphoprotein (Protein P) (Protein M1)
Vesicular Stomatitis Indiana Virus (strain Mudd-Summers) (VSIV)
Viruses> SsRNA Viruses> SsRNA Negative-strand Viruses> Mononegavirales> Rhabdoviridae> Vesiculovirus> Indiana Vesiculovirus> Vesicular Stomatitis Indiana Virus> Vesicular Stomatitis Indiana Virus (strain Mudd-Summers) (VSIV)
Various pathway(s) in which protein is involved
Not Available
Not Available
MDNLTKVREYLKSYSRLDQAVGEIDEIEAQRAEKSNYELFQEDGVEEHTRPSYFQAADDSDTESEPEIEDNQGLYVPDPEAEQVEGFIQGPLDDYADEDV
DVVFTSDWKQPELESDEHGKTLRLTLPEGLSGEQKSQWLLTIKAVVQSAKHWNLAECTFEASGEGVIIKKRQITPDVYKVTPVMNTHPYQSEAVSDVWSL
SKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
DVVFTSDWKQPELESDEHGKTLRLTLPEGLSGEQKSQWLLTIKAVVQSAKHWNLAECTFEASGEGVIIKKRQITPDVYKVTPVMNTHPYQSEAVSDVWSL
SKTSMTFQPKKASLQPLTISLDELFSSRGEFISVGGNGRMSHKEAILLGLRYKKLYNQARVKYSL
265
Not Available
Not Available
13-08-1987
Evidence at protein level
Amino Acid | Count | % Frequency | Amino Acid | Count | % Frequency |
---|---|---|---|---|---|
Alanine (A) | Leucine (L) | ||||
Arginine (R) | Lysine (K) | ||||
Asparagine (N) | Methionine (M) | ||||
Aspartic Acid (D) | Phenylalanine (F) | ||||
Cysteine (C) | Proline (P) | ||||
Glutamine (Q) | Serine (S) | ||||
Glutamic Acid (E) | Threonine (T) | ||||
Glycine (G) | Tryptophan (W) | ||||
Histidine (H) | Tyrosine (Y) | ||||
Isoleucine (I) | Valine (V) |
% Number of Residues in Helices | % Number of Residues in Strands | % Number of Residues in Coils |
---|---|---|
Essential component of the RNA polymerase transcription and replication complex. Binds the viral ribonucleocapsid and positions the L polymerase on the template. May act as a chaperone for newly synthesized free N protein, so-called N(0). Plays a role in virion assembly (By similarity).
Not Available
Virion. Host cytoplasm .
Not Available
Not Available
X-ray crystallography (3)
Not Available
Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.
Not Available
- Million Molecules
Best 20 Hit molecules
Not Available