Results | viHumans

UniProt ID

P04615

Status

Reviewed

Host

Homo Sapiens (Human) [TaxID: 9606]

Gene Name

Rev

Protein Name

Protein Rev (Regulator of expression of viral proteins)

Organism Name

Human Immunodeficiency Virus Type 2 Subtype A (isolate ROD) (HIV-2)

Taxonomic Lineage

Viruses> Retro-transcribing Viruses> Retroviridae> Orthoretrovirinae> Lentivirus> Primate Lentivirus Group> Human Immunodeficiency Virus 2> HIV-2 Subtype A> Human Immunodeficiency Virus Type 2 Subtype A (isolate ROD) (HIV-2)

RefSeq

NC_001722.1 ; M30502.1

PubMed ID

3031510 ; 2200888

Pathways Involved

Various pathway(s) in which protein is involved

KEGG

Not Available

Reactome

Not Available

Sequence

							MNERADEEGLQRKLRLIRLLHQTNPYPQGPGTASQRRNRRRRWKQRWRQILALADSIYTFPDPPADSPLDQTIQHLQGLTIQELPDPPTHLPESQRLAET
						

Length

100

Alternate Sequence

Not Available

Non-standard residue

Not Available

Date of last Sequence modification

13-08-1987

Protein Existence

Inferred from homology

Amino Acid composition

Amino Acid	Count	% Frequency	Amino Acid	Count	% Frequency
Alanine (A)			Leucine (L)
Arginine (R)			Lysine (K)
Asparagine (N)			Methionine (M)
Aspartic Acid (D)			Phenylalanine (F)
Cysteine (C)			Proline (P)
Glutamine (Q)			Serine (S)
Glutamic Acid (E)			Threonine (T)
Glycine (G)			Tryptophan (W)
Histidine (H)			Tyrosine (Y)
Isoleucine (I)			Valine (V)

Sum of Absolute Deviation from Amino Acid Occurrence Frequencies

Aliphatic Index

Instability Index

Secondary Structure features

% Number of Residues in Helices	% Number of Residues in Strands	% Number of Residues in Coils

Structural Difficulty(SD) index

Role(s)

Escorts unspliced or incompletely spliced viral pre-mRNAs (late transcripts) out of the nucleus of infected cells. These pre-mRNAs carry a recognition sequence called Rev responsive element (RRE) located in the env gene, that is not present in fully spliced viral mRNAs (early transcripts). This function is essential since most viral proteins are translated from unspliced or partially spliced pre-mRNAs which cannot exit the nucleus by the pathway used by fully processed cellular mRNAs (By similarity).

EC

Not Available

Experimentally known GO terms

GO:0003700 ; GO:0003723 ; GO:0030430 ; GO:0044196 ; GO:0051028

Subcellular Location

Host nucleus, host nucleolus. Host cytoplasm. Note=The presence of both nuclear import and nuclear export signals leads to continuous shuttling between the nucleus and cytoplasm. .

Domain(s)

Not Available

Motif(s)

MOTIF 35 49 Nuclear localization signal and RNA-binding (RRE). ; MOTIF 71 82 Nuclear export signal and binding to XPO1.

Methods of 3D structure generation

Predicted/Modelled

Experimetally known structure

Not Available

Active Site(s)

Not Available

Predicted 3D Structures

Protein couldn't be modeled using I-Tasser and Raptor X because of length constraints of the software.

Experimentally known Ligand(s)

Not Available

Virtually Screened Ligands

Virtual screening has been performed using RASPD

						Million Molecules

					
Best 20 Hit molecules 
Not Available